Lineage for d2q62g_ (2q62 G:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1837702Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1838447Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 1838784Family c.23.5.4: NADPH-dependent FMN reductase [89590] (5 proteins)
    Pfam PF03358
  6. 1838808Protein automated matches [190892] (2 species)
    not a true protein
  7. 1838830Species Rhizobium meliloti (Sinorhizobium meliloti) [TaxId:382] [188302] (1 PDB entry)
  8. 1838837Domain d2q62g_: 2q62 G: [167441]
    automated match to d2fzva1
    complexed with so4

Details for d2q62g_

PDB Entry: 2q62 (more details), 1.8 Å

PDB Description: Crystal Structure of ArsH from Sinorhizobium meliloti
PDB Compounds: (G:) arsH

SCOPe Domain Sequences for d2q62g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q62g_ c.23.5.4 (G:) automated matches {Rhizobium meliloti (Sinorhizobium meliloti) [TaxId: 382]}
hdlpaanlqqlrlpdsaslrpafsthrprililygslrtvsysrllaeearrlleffgae
vkvfdpsglplpdaapvshpkvqelrelsiwsegqvwvsperhgamtgimkaqidwipls
tgsirptqgktlavmqvsggsqsfnavnqmrilgrwmrmitipnqssvakafqefdangr
mkpssyydrvvdvmeelvkftlltrdcsayltdryserk

SCOPe Domain Coordinates for d2q62g_:

Click to download the PDB-style file with coordinates for d2q62g_.
(The format of our PDB-style files is described here.)

Timeline for d2q62g_: