![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.5: Flavoproteins [52218] (9 families) ![]() |
![]() | Family c.23.5.4: NADPH-dependent FMN reductase [89590] (5 proteins) Pfam PF03358 |
![]() | Protein automated matches [190892] (2 species) not a true protein |
![]() | Species Rhizobium meliloti (Sinorhizobium meliloti) [TaxId:382] [188302] (1 PDB entry) |
![]() | Domain d2q62g_: 2q62 G: [167441] automated match to d2fzva1 complexed with so4 |
PDB Entry: 2q62 (more details), 1.8 Å
SCOPe Domain Sequences for d2q62g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2q62g_ c.23.5.4 (G:) automated matches {Rhizobium meliloti (Sinorhizobium meliloti) [TaxId: 382]} hdlpaanlqqlrlpdsaslrpafsthrprililygslrtvsysrllaeearrlleffgae vkvfdpsglplpdaapvshpkvqelrelsiwsegqvwvsperhgamtgimkaqidwipls tgsirptqgktlavmqvsggsqsfnavnqmrilgrwmrmitipnqssvakafqefdangr mkpssyydrvvdvmeelvkftlltrdcsayltdryserk
Timeline for d2q62g_: