Lineage for d1qghi_ (1qgh I:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 212183Fold a.25: Ferritin-like [47239] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 212184Superfamily a.25.1: Ferritin-like [47240] (2 families) (S)
    contains dimetal-ion centre in the middle of the bundle
  5. 212185Family a.25.1.1: Ferritin [47241] (5 proteins)
  6. 212268Protein Dodecameric ferritin homolog [47250] (5 species)
  7. 212305Species Listeria innocua [TaxId:1642] [47252] (1 PDB entry)
  8. 212314Domain d1qghi_: 1qgh I: [16736]

Details for d1qghi_

PDB Entry: 1qgh (more details), 2.35 Å

PDB Description: the x-ray structure of the unusual dodecameric ferritin from listeria innocua, reveals a novel intersubunit iron binding site.

SCOP Domain Sequences for d1qghi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qghi_ a.25.1.1 (I:) Dodecameric ferritin homolog {Listeria innocua}
vdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdevaerlla
iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegdd
vtndmliafkasidkhiwmfkaflgkaple

SCOP Domain Coordinates for d1qghi_:

Click to download the PDB-style file with coordinates for d1qghi_.
(The format of our PDB-style files is described here.)

Timeline for d1qghi_: