Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.18: PLC-like phosphodiesterases [51695] (4 families) |
Family c.1.18.0: automated matches [191539] (1 protein) not a true family |
Protein automated matches [190919] (6 species) not a true protein |
Species Thermoanaerobacter tengcongensis [TaxId:273068] [188407] (1 PDB entry) |
Domain d2pz0a_: 2pz0 A: [167354] automated match to d1o1za_ complexed with ca, gol |
PDB Entry: 2pz0 (more details), 1.91 Å
SCOPe Domain Sequences for d2pz0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pz0a_ c.1.18.0 (A:) automated matches {Thermoanaerobacter tengcongensis [TaxId: 273068]} ktlviahrgdsknvpentiaafkramelgadgieldvqltkdghlvvihdetvdrttnge gfvkdftleeikkldagikfgekfageriptlyevfeligdkdflvnieiksgivlypgi eeklikaikeynfeerviissfnhyslrdvkkmaphlkigllyqcglvepwhmalrmeay slhpfyfniipelvegckkngvklfpwtvdrkedmermikagvdgiitddpetlinlvr
Timeline for d2pz0a_: