Lineage for d2ps1a_ (2ps1 A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1377621Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 1377622Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 1378000Family c.61.1.0: automated matches [191528] (1 protein)
    not a true family
  6. 1378001Protein automated matches [190891] (18 species)
    not a true protein
  7. 1378024Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [188318] (3 PDB entries)
  8. 1378025Domain d2ps1a_: 2ps1 A: [167257]
    automated match to d1lh0a_
    complexed with mg, oro, prp

Details for d2ps1a_

PDB Entry: 2ps1 (more details), 1.75 Å

PDB Description: s. cerevisiae orotate phosphoribosyltransferase complexed with orotic acid and prpp
PDB Compounds: (A:) Orotate phosphoribosyltransferase 1

SCOPe Domain Sequences for d2ps1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ps1a_ c.61.1.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
imledyqknflelaiecqalrfgsfklksgrespyffnlglfntgkllsnlatayaiaii
qsdlkfdvifgpaykgiplaaivcvklaeiggskfqniqyafnrkeakdhgeggiivgsa
lenkriliiddvmtagtaineafeiisnakgqvvgsiialdrqevvstddkeglsatqtv
skkygipvlsivslihiitylegritaeekskieqylqtygasa

SCOPe Domain Coordinates for d2ps1a_:

Click to download the PDB-style file with coordinates for d2ps1a_.
(The format of our PDB-style files is described here.)

Timeline for d2ps1a_: