Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
Superfamily c.61.1: PRTase-like [53271] (3 families) |
Family c.61.1.0: automated matches [191528] (1 protein) not a true family |
Protein automated matches [190891] (18 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [188318] (3 PDB entries) |
Domain d2ps1a_: 2ps1 A: [167257] automated match to d1lh0a_ complexed with mg, oro, prp |
PDB Entry: 2ps1 (more details), 1.75 Å
SCOPe Domain Sequences for d2ps1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ps1a_ c.61.1.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} imledyqknflelaiecqalrfgsfklksgrespyffnlglfntgkllsnlatayaiaii qsdlkfdvifgpaykgiplaaivcvklaeiggskfqniqyafnrkeakdhgeggiivgsa lenkriliiddvmtagtaineafeiisnakgqvvgsiialdrqevvstddkeglsatqtv skkygipvlsivslihiitylegritaeekskieqylqtygasa
Timeline for d2ps1a_: