Lineage for d1dpsj_ (1dps J:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2314151Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2314152Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2314869Protein Dodecameric ferritin homolog [47250] (16 species)
  7. 2314920Species Escherichia coli, Dps [TaxId:562] [47251] (8 PDB entries)
    ferritin homolog that binds to and protects DNA
  8. 2314930Domain d1dpsj_: 1dps J: [16725]
    complexed with na

Details for d1dpsj_

PDB Entry: 1dps (more details), 1.6 Å

PDB Description: the crystal structure of dps, a ferritin homolog that binds and protects dna
PDB Compounds: (J:) dps

SCOPe Domain Sequences for d1dpsj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dpsj_ a.25.1.1 (J:) Dodecameric ferritin homolog {Escherichia coli, Dps [TaxId: 562]}
llytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrtal
idhldtmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivandvr
kaigeakdddtadiltaasrdldkflwfiecnie

SCOPe Domain Coordinates for d1dpsj_:

Click to download the PDB-style file with coordinates for d1dpsj_.
(The format of our PDB-style files is described here.)

Timeline for d1dpsj_: