SCOPe 2.08: Domain d2pk0c1: 2pk0 C:1-241

Lineage for d2pk0c1 (2pk0 C:1-241)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.219: PP2C-like [81607] (1 superfamily)
   4 layers: alpha/beta/beta/alpha; antiparallel beta sheets

4. Superfamily d.219.1: PP2C-like [81606] (2 families)
   contain binuclear metal (Mn) centre

5. Family d.219.1.0: automated matches [191371] (1 protein)
   not a true family

6. Protein automated matches [190449] (7 species)
   not a true protein

7. Species Streptococcus agalactiae [TaxId:205921] [188548] (1 PDB entry)

8. Domain d2pk0c1: 2pk0 C:1-241 [167202]
   Other proteins in same PDB: d2pk0a2, d2pk0b2, d2pk0c2, d2pk0d2
   automated match to d1txoa_
   complexed with cl, gol, mg

Details for d2pk0c1

PDB Entry: 2pk0, 2.65 Å

PDB Description: Structure of the S. agalactiae serine/threonine phosphatase at 2.65 resolution

PDB Compounds: (C:) Serine/threonine protein phosphatase Stp1

SCOPe Domain Sequences for d2pk0c1:

Sequence; same for both SEQRES and ATOM records:

>d2pk0c1 d.219.1.0 (C:1-241) automated matches {Streptococcus agalactiae [TaxId: 205921]}
meislltdigqrrsnnqdfinqfenkagvpliiladgmgghragniasemtvtdlgsdwa
etdfselseirdwmlvsietenrkiyelgqsddykgmgttieavaivgdniifahvgdsr
igivrqgeyhlltsdhslvnelvkagqlteeeaashpqkniitqsigqanpvepdlgvhl
leegdylvvnsdgltnmlsnadiatvltqektlddknqdlitlanhrggldnitvalvyv
e

Timeline for d2pk0c1:

• d2pk0c1 first appeared in SCOPe 2.01, called d2pk0c_
  
• d2pk0c1 appears in SCOPe 2.07