Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.219: PP2C-like [81607] (1 superfamily) 4 layers: alpha/beta/beta/alpha; antiparallel beta sheets |
Superfamily d.219.1: PP2C-like [81606] (2 families) contain binuclear metal (Mn) centre |
Family d.219.1.1: PP2C-like [81605] (3 proteins) Pfam PF00481 |
Protein putative serine/threonine phosphatase pstp/ppp [118149] (1 species) |
Species Mycobacterium tuberculosis [TaxId:1773] [118150] (1 PDB entry) Uniprot P71588 |
Domain d1txoa_: 1txo A: [112781] complexed with mn |
PDB Entry: 1txo (more details), 1.95 Å
SCOPe Domain Sequences for d1txoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1txoa_ d.219.1.1 (A:) putative serine/threonine phosphatase pstp/ppp {Mycobacterium tuberculosis [TaxId: 1773]} lvlryaarsdrglvrannedsvyagarllaladgmgghaagevasqlviaalahldddep ggdllakldaavragnsaiaaqvemepdlegmgttltailfagnrlglvhigdsrgyllr dgeltqitkddtfvqtlvdegritpeeahshpqrslimraltgheveptltmrearagdr yllcsdglsdpvsdetilealqipevaesahrlielalrgggpdnvtvvvadleh
Timeline for d1txoa_: