Lineage for d1txob_ (1txo B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3007405Fold d.219: PP2C-like [81607] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; antiparallel beta sheets
  4. 3007406Superfamily d.219.1: PP2C-like [81606] (2 families) (S)
    contain binuclear metal (Mn) centre
  5. 3007407Family d.219.1.1: PP2C-like [81605] (3 proteins)
    Pfam PF00481
  6. 3007411Protein putative serine/threonine phosphatase pstp/ppp [118149] (1 species)
  7. 3007412Species Mycobacterium tuberculosis [TaxId:1773] [118150] (1 PDB entry)
    Uniprot P71588
  8. 3007414Domain d1txob_: 1txo B: [112782]
    complexed with mn

Details for d1txob_

PDB Entry: 1txo (more details), 1.95 Å

PDB Description: crystal structure of the mycobacterium tuberculosis serine/threonine phosphatase pstp/ppp at 1.95 a.
PDB Compounds: (B:) Putative Bacterial Enzyme

SCOPe Domain Sequences for d1txob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1txob_ d.219.1.1 (B:) putative serine/threonine phosphatase pstp/ppp {Mycobacterium tuberculosis [TaxId: 1773]}
tlvlryaarsdrglvrannedsvyagarllaladgmgghaagevasqlviaalahlddde
pggdllakldaavragnsaiaaqvemepdlegmgttltailfagnrlglvhigdsrgyll
rdgeltqitkddtfvqtlvdegritpeeahshpqrslimraltgheveptltmrearagd
ryllcsdglsdpvsdetilealqipevaesahrlielalrgggpdnvtvvvadleh

SCOPe Domain Coordinates for d1txob_:

Click to download the PDB-style file with coordinates for d1txob_.
(The format of our PDB-style files is described here.)

Timeline for d1txob_: