SCOPe 2.08: Domain d1txob_: 1txo B:

Lineage for d1txob_ (1txo B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.219: PP2C-like [81607] (1 superfamily)
   4 layers: alpha/beta/beta/alpha; antiparallel beta sheets

4. Superfamily d.219.1: PP2C-like [81606] (2 families)
   contain binuclear metal (Mn) centre

5. Family d.219.1.1: PP2C-like [81605] (3 proteins)
   Pfam PF00481

6. Protein putative serine/threonine phosphatase pstp/ppp [118149] (1 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [118150] (1 PDB entry)
   Uniprot P71588

8. Domain d1txob_: 1txo B: [112782]
   complexed with mn

Details for d1txob_

PDB Entry: 1txo, 1.95 Å

PDB Description: crystal structure of the mycobacterium tuberculosis serine/threonine phosphatase pstp/ppp at 1.95 a.

PDB Compounds: (B:) Putative Bacterial Enzyme

SCOPe Domain Sequences for d1txob_:

Sequence; same for both SEQRES and ATOM records:

>d1txob_ d.219.1.1 (B:) putative serine/threonine phosphatase pstp/ppp {Mycobacterium tuberculosis [TaxId: 1773]}
tlvlryaarsdrglvrannedsvyagarllaladgmgghaagevasqlviaalahlddde
pggdllakldaavragnsaiaaqvemepdlegmgttltailfagnrlglvhigdsrgyll
rdgeltqitkddtfvqtlvdegritpeeahshpqrslimraltgheveptltmrearagd
ryllcsdglsdpvsdetilealqipevaesahrlielalrgggpdnvtvvvadleh

Timeline for d1txob_:

• d1txob_ first appeared in SCOP 1.71
  
• d1txob_ appears in SCOPe 2.07