SCOPe 2.01: Domain d2pedb_: 2ped B:

Lineage for d2pedb_ (2ped B:)

1. Root: SCOPe 2.01

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.13: Family A G protein-coupled receptor-like [81322] (1 superfamily)
   core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane

4. Superfamily f.13.1: Family A G protein-coupled receptor-like [81321] (2 families)

5. Family f.13.1.2: Rhodopsin-like [81320] (2 proteins)
   Individual TM segments have a number of kinks and distortions

6. Protein automated matches [190300] (1 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [188510] (7 PDB entries)

8. Domain d2pedb_: 2ped B: [167162]
   automated match to d1f88a_
   complexed with hg, htg, hto, plm, ret, zn

Details for d2pedb_

PDB Entry: 2ped, 2.95 Å

PDB Description: crystallographic model of 9-cis-rhodopsin

PDB Compounds: (B:) rhodopsin

SCOPe Domain Sequences for d2pedb_:

Sequence; same for both SEQRES and ATOM records:

>d2pedb_ f.13.1.2 (B:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
mngtegpnfyvpfsnktgvvrspfeapqyylaepwqfsmlaaymfllimlgfpinfltly
vtvqhkklrtplnyillnlavadlfmvfggftttlytslhgyfvfgptgcnlegffatlg
geialwslvvlaieryvvvckpmsnfrfgenhaimgvaftwvmalacaapplvgwsryip
egmqcscgidyytpheetnnesfviymfvvhfiipliviffcygqlvftvkeaaaqqqes
attqkaekevtrmviimviaflicwlpyagvafyifthqgsdfgpifmtipaffaktsav
ynpviyimmnkqfrncmvttlccgknplgddeasttvsktetsqvapa

Timeline for d2pedb_:

• d2pedb_ is new in SCOPe 2.01-stable
  
• d2pedb_ appears in SCOPe 2.02
  
• d2pedb_ appears in the current release, SCOPe 2.08