Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.55: DOPA-like [143410] (2 families) probable biological unit is homodimer; the extra C-terminal strand, adjacent and antiparallel to strand 4, contributes to the dimerisation interface |
Family d.58.55.0: automated matches [191479] (1 protein) not a true family |
Protein automated matches [190768] (1 species) not a true protein |
Species Nostoc punctiforme [TaxId:63737] [187985] (1 PDB entry) |
Domain d2pebb_: 2peb B: [167160] automated match to d2nyha1 complexed with edo, pg4, unl, zn |
PDB Entry: 2peb (more details), 1.46 Å
SCOPe Domain Sequences for d2pebb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pebb_ d.58.55.0 (B:) automated matches {Nostoc punctiforme [TaxId: 63737]} kedtieiagfhahvyfdaasrdvaarvreglgarfevqlgrwfdkpigphpkgmyqvafl pnqfdkvvpwlmlnregldilvhpetgdavsdhavyslwlgaalalnieflrqls
Timeline for d2pebb_: