Lineage for d2pebb_ (2peb B:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1026488Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1030324Superfamily d.58.55: DOPA-like [143410] (2 families) (S)
    probable biological unit is homodimer; the extra C-terminal strand, adjacent and antiparallel to strand 4, contributes to the dimerisation interface
  5. 1030334Family d.58.55.0: automated matches [191479] (1 protein)
    not a true family
  6. 1030335Protein automated matches [190768] (1 species)
    not a true protein
  7. 1030336Species Nostoc punctiforme [TaxId:63737] [187985] (1 PDB entry)
  8. 1030338Domain d2pebb_: 2peb B: [167160]
    automated match to d2nyha1
    complexed with edo, pg4, unl, zn

Details for d2pebb_

PDB Entry: 2peb (more details), 1.46 Å

PDB Description: crystal structure of a putative dioxygenase (npun_f1925) from nostoc punctiforme pcc 73102 at 1.46 a resolution
PDB Compounds: (B:) Putative dioxygenase

SCOPe Domain Sequences for d2pebb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pebb_ d.58.55.0 (B:) automated matches {Nostoc punctiforme [TaxId: 63737]}
kedtieiagfhahvyfdaasrdvaarvreglgarfevqlgrwfdkpigphpkgmyqvafl
pnqfdkvvpwlmlnregldilvhpetgdavsdhavyslwlgaalalnieflrqls

SCOPe Domain Coordinates for d2pebb_:

Click to download the PDB-style file with coordinates for d2pebb_.
(The format of our PDB-style files is described here.)

Timeline for d2pebb_: