SCOPe 2.02: Domain d2peba_: 2peb A:

Lineage for d2peba_ (2peb A:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.55: DOPA-like [143410] (2 families)
   probable biological unit is homodimer; the extra C-terminal strand, adjacent and antiparallel to strand 4, contributes to the dimerisation interface

5. Family d.58.55.0: automated matches [191479] (1 protein)
   not a true family

6. Protein automated matches [190768] (1 species)
   not a true protein

7. Species Nostoc punctiforme [TaxId:63737] [187985] (1 PDB entry)

8. Domain d2peba_: 2peb A: [167159]
   automated match to d2nyha1
   complexed with edo, pg4, unl, zn

Details for d2peba_

PDB Entry: 2peb, 1.46 Å

PDB Description: crystal structure of a putative dioxygenase (npun_f1925) from nostoc punctiforme pcc 73102 at 1.46 a resolution

PDB Compounds: (A:) Putative dioxygenase

SCOPe Domain Sequences for d2peba_:

Sequence; same for both SEQRES and ATOM records:

>d2peba_ d.58.55.0 (A:) automated matches {Nostoc punctiforme [TaxId: 63737]}
kedtieiagfhahvyfdaasrdvaarvreglgarfevqlgrwfdkpigphpkgmyqvafl
pnqfdkvvpwlmlnregldilvhpetgdavsdhavyslwlgaalalnieflrqls

Timeline for d2peba_:

• d2peba_ first appeared in SCOPe 2.01
  
• d2peba_ appears in SCOPe 2.03
  
• d2peba_ appears in the current release, SCOPe 2.08