SCOPe 2.06: Domain d2pdqa_: 2pdq A:

Lineage for d2pdqa_ (2pdq A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families)

5. Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
   Common fold covers whole protein structure

6. Protein Aldose reductase (aldehyde reductase) [51436] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [51437] (135 PDB entries)
   Uniprot P15121

8. Domain d2pdqa_: 2pdq A: [167154]
   automated match to d1el3a_
   complexed with 47d, nap; mutant

Details for d2pdqa_

PDB Entry: 2pdq, 1.73 Å

PDB Description: human aldose reductase mutant c303d complexed with uracil-type inhibitor.

PDB Compounds: (A:) aldose reductase

SCOPe Domain Sequences for d2pdqa_:

Sequence; same for both SEQRES and ATOM records:

>d2pdqa_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Human (Homo sapiens) [TaxId: 9606]}
asrillnngakmpilglgtwksppgqvteavkvaidvgyrhidcahvyqnenevgvaiqe
klreqvvkreelfivsklwctyhekglvkgacqktlsdlkldyldlylihwptgfkpgke
ffpldesgnvvpsdtnildtwaameelvdeglvkaigisnfnhlqvemilnkpglkykpa
vnqiechpyltqekliqycqskgivvtaysplgspdrpwakpedpslledprikaiaakh
nkttaqvlirfpmqrnlvvipksvtperiaenfkvfdfelssqdmttllsynrnwrvcal
lsdtshkdypfheef

Timeline for d2pdqa_:

• d2pdqa_ first appeared in SCOPe 2.01
  
• d2pdqa_ appears in SCOPe 2.05
  
• d2pdqa_ appears in SCOPe 2.07
  
• d2pdqa_ appears in the current release, SCOPe 2.08