SCOPe 2.02: Domain d2p7ob_: 2p7o B:

Lineage for d2p7ob_ (2p7o B:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families)

5. Family d.32.1.2: Antibiotic resistance proteins [54598] (8 proteins)
   duplication: consists of two clear structural repeats each having this fold
   subunit fold and dimeric assembly are similar to those of glyoxalase

6. Protein automated matches [190190] (5 species)
   not a true protein

7. Species Listeria monocytogenes [TaxId:169963] [187361] (5 PDB entries)

8. Domain d2p7ob_: 2p7o B: [167065]
   automated match to d1r9ca_
   complexed with mn

Details for d2p7ob_

PDB Entry: 2p7o, 1.44 Å

PDB Description: Crystal structure of genomically encoded fosfomycin resistance protein, FosX, from Listeria monocytogenes (tetragonal form)

PDB Compounds: (B:) Glyoxalase family protein

SCOPe Domain Sequences for d2p7ob_:

Sequence, based on SEQRES records:

>d2p7ob_ d.32.1.2 (B:) automated matches {Listeria monocytogenes [TaxId: 169963]}
misglshitlivkdlnkttaflqnifnaeeiyssgdktfslskekffliaglwicimegd
slqertynhiafqiqseevdeyterikalgvemkperprvqgegrsiyfydfdnhlfelh
agtleerlkry

Sequence, based on observed residues (ATOM records):

>d2p7ob_ d.32.1.2 (B:) automated matches {Listeria monocytogenes [TaxId: 169963]}
misglshitlivkdlnkttaflqnifnaeeiytfslskekffliaglwicimegdslqer
tynhiafqiqseevdeyterikalgvemkperprvqgegrsiyfydfdnhlfelhagtle
erlkry

Timeline for d2p7ob_:

• d2p7ob_ first appeared in SCOPe 2.01
  
• d2p7ob_ appears in SCOPe 2.03
  
• d2p7ob_ appears in the current release, SCOPe 2.08