![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
![]() | Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) ![]() |
![]() | Family d.32.1.2: Antibiotic resistance proteins [54598] (8 proteins) duplication: consists of two clear structural repeats each having this fold subunit fold and dimeric assembly are similar to those of glyoxalase |
![]() | Protein automated matches [190190] (5 species) not a true protein |
![]() | Species Listeria monocytogenes [TaxId:169963] [187361] (5 PDB entries) |
![]() | Domain d2p7oa_: 2p7o A: [167064] automated match to d1r9ca_ complexed with mn |
PDB Entry: 2p7o (more details), 1.44 Å
SCOPe Domain Sequences for d2p7oa_:
Sequence, based on SEQRES records: (download)
>d2p7oa_ d.32.1.2 (A:) automated matches {Listeria monocytogenes [TaxId: 169963]} misglshitlivkdlnkttaflqnifnaeeiyssgdktfslskekffliaglwicimegd slqertynhiafqiqseevdeyterikalgvemkperprvqgegrsiyfydfdnhlfelh agtleerlkryh
>d2p7oa_ d.32.1.2 (A:) automated matches {Listeria monocytogenes [TaxId: 169963]} misglshitlivkdlnkttaflqnifnaeeiytfslskekffliaglwicimegdslqer tynhiafqiqseevdeyterikalgvemkperprvqgegrsiyfydfdnhlfelhagtle erlkryh
Timeline for d2p7oa_: