SCOPe 2.02: Domain d2p74b_: 2p74 B:

Lineage for d2p74b_ (2p74 B:)

1. Root: SCOPe 2.02

2. Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)

6. Protein automated matches [190161] (15 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187306] (30 PDB entries)

8. Domain d2p74b_: 2p74 B: [167043]
   automated match to d1iyqa_
   complexed with k, po4

Details for d2p74b_

PDB Entry: 2p74, 0.88 Å

PDB Description: ctx-m-9 class a beta-lactamase apo crystal structure at 0.88 angstrom resolution

PDB Compounds: (B:) Beta-lactamase CTX-M-9a

SCOPe Domain Sequences for d2p74b_:

Sequence; same for both SEQRES and ATOM records:

>d2p74b_ e.3.1.1 (B:) automated matches {Escherichia coli [TaxId: 562]}
avqqklaalekssggrlgvalidtadntqvlyrgderfpmcstskvmaaaavlkqsetqk
qllnqpveikpadlvnynpiaekhvngtmtlaelsaaalqysdntamnkliaqlggpggv
tafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqraqlv
twlkgnttgaasiraglptswtagdktgsgdygttndiaviwpqgraplvlvtyftqpqq
naesrrdvlasaariiaegl

Timeline for d2p74b_:

• d2p74b_ first appeared in SCOPe 2.01
  
• d2p74b_ appears in SCOPe 2.03
  
• d2p74b_ appears in the current release, SCOPe 2.08