Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.20: Extended AAA-ATPase domain [81269] (29 proteins) fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain |
Protein automated matches [190766] (3 species) not a true protein |
Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [187983] (1 PDB entry) |
Domain d2p65a_: 2p65 A: [167022] automated match to d1jbka_ |
PDB Entry: 2p65 (more details), 1.7 Å
SCOPe Domain Sequences for d2p65a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p65a_ c.37.1.20 (A:) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} qalekysrdltalaragkldpvigrdteirraiqilsrrtknnpillgdpgvgktaiveg laikivqgdvpdslkgrklvsldlssliagakyrgdfeerlksilkevqdaegqvvmfid eihtvvgagavaegaldagnilkpmlargelrcigattvseyrqfiekdkalerrfqqil veqps
Timeline for d2p65a_: