Lineage for d2p65a_ (2p65 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1849193Family c.37.1.20: Extended AAA-ATPase domain [81269] (29 proteins)
    fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
  6. 1849496Protein automated matches [190766] (3 species)
    not a true protein
  7. 1849540Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [187983] (1 PDB entry)
  8. 1849541Domain d2p65a_: 2p65 A: [167022]
    automated match to d1jbka_

Details for d2p65a_

PDB Entry: 2p65 (more details), 1.7 Å

PDB Description: Crystal Structure of the first nucleotide binding domain of chaperone ClpB1, putative, (Pv089580) from Plasmodium Vivax
PDB Compounds: (A:) Hypothetical protein PF08_0063

SCOPe Domain Sequences for d2p65a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p65a_ c.37.1.20 (A:) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
qalekysrdltalaragkldpvigrdteirraiqilsrrtknnpillgdpgvgktaiveg
laikivqgdvpdslkgrklvsldlssliagakyrgdfeerlksilkevqdaegqvvmfid
eihtvvgagavaegaldagnilkpmlargelrcigattvseyrqfiekdkalerrfqqil
veqps

SCOPe Domain Coordinates for d2p65a_:

Click to download the PDB-style file with coordinates for d2p65a_.
(The format of our PDB-style files is described here.)

Timeline for d2p65a_: