SCOPe 2.06: Domain d2p65a_: 2p65 A:

Lineage for d2p65a_ (2p65 A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.20: Extended AAA-ATPase domain [81269] (29 proteins)
   fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain

6. Protein automated matches [190766] (4 species)
   not a true protein

7. Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [187983] (1 PDB entry)

8. Domain d2p65a_: 2p65 A: [167022]
   automated match to d1jbka_

Details for d2p65a_

PDB Entry: 2p65, 1.7 Å

PDB Description: Crystal Structure of the first nucleotide binding domain of chaperone ClpB1, putative, (Pv089580) from Plasmodium Vivax

PDB Compounds: (A:) Hypothetical protein PF08_0063

SCOPe Domain Sequences for d2p65a_:

Sequence; same for both SEQRES and ATOM records:

>d2p65a_ c.37.1.20 (A:) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
qalekysrdltalaragkldpvigrdteirraiqilsrrtknnpillgdpgvgktaiveg
laikivqgdvpdslkgrklvsldlssliagakyrgdfeerlksilkevqdaegqvvmfid
eihtvvgagavaegaldagnilkpmlargelrcigattvseyrqfiekdkalerrfqqil
veqps

Timeline for d2p65a_:

• d2p65a_ first appeared in SCOPe 2.01
  
• d2p65a_ appears in SCOPe 2.05
  
• d2p65a_ appears in SCOPe 2.07
  
• d2p65a_ appears in the current release, SCOPe 2.08