Class b: All beta proteins [48724] (178 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.3: Nucleoplasmin-like core domain [69203] (2 families) oligomerizes into a pentameric ring structure |
Family b.121.3.1: Nucleoplasmin-like core domain [69204] (4 proteins) automatically mapped to Pfam PF03066 |
Protein automated matches [190762] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187973] (2 PDB entries) |
Domain d2p1ba_: 2p1b A: [166935] automated match to d1xb9a_ |
PDB Entry: 2p1b (more details), 2.75 Å
SCOPe Domain Sequences for d2p1ba_:
Sequence, based on SEQRES records: (download)
>d2p1ba_ b.121.3.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} qnylfgcelkadkdyhfkvdndenehqlslrtvslgagakdelhiveaeamnyegspikv tlatlkmsvqptvslggfeitppvvlrlkcgsgpvhisgqhlva
>d2p1ba_ b.121.3.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} qnylfgcelkadkdyhfkvdehqlslrtvslgagakdelhiveaeamnyegspikvtlat lkmsvqptvslggfeitppvvlrlkcgsgpvhisgqhlva
Timeline for d2p1ba_: