SCOPe 2.04: Domain d2p0wa_: 2p0w A:

Lineage for d2p0wa_ (2p0w A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families)

5. Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)

6. Protein Histone acetyltransferase HAT1 [55742] (2 species)
   contains additional N- and C-terminal (sub)domains

7. Species Human (Homo sapiens) [TaxId:9606] [187971] (1 PDB entry)

8. Domain d2p0wa_: 2p0w A: [166931]
   automated match to d1boba_
   complexed with acm, aco, act, cl

Details for d2p0wa_

PDB Entry: 2p0w, 1.9 Å

PDB Description: Human histone acetyltransferase 1 (HAT1)

PDB Compounds: (A:) Histone acetyltransferase type B catalytic subunit

SCOPe Domain Sequences for d2p0wa_:

Sequence; same for both SEQRES and ATOM records:

>d2p0wa_ d.108.1.1 (A:) Histone acetyltransferase HAT1 {Human (Homo sapiens) [TaxId: 9606]}
aeykcntntaielklvrfpedlendirtffpeythqlfgddetafgykglkillyyiags
lstmfrveyaskvdenfdcveaddvegkirqiippgfctntndflsllekevdfkpfgtl
lhtysvlsptggenftfqiykadmtcrgfreyherlqtflmwfietasfidvdderwhyf
lvfekynkdgatlfatvgymtvynyyvypdktrprvsqmliltpfqgqghgaqlletvhr
yytefptvlditaedpsksyvklrdfvlvklcqdlpcfsreklmqgfnedmaieaqqkfk
inkqharrvyeilrllvtd

Timeline for d2p0wa_:

• d2p0wa_ first appeared in SCOPe 2.01
  
• d2p0wa_ appears in SCOPe 2.03
  
• d2p0wa_ appears in SCOPe 2.05
  
• d2p0wa_ appears in the current release, SCOPe 2.08