SCOPe 2.05: Domain d2oxva_: 2oxv A:

Lineage for d2oxva_ (2oxv A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.1: Restriction endonuclease-like [52980] (35 families)

5. Family c.52.1.1: Restriction endonuclease EcoRI [52981] (2 proteins)
   automatically mapped to Pfam PF02963

6. Protein automated matches [190876] (1 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [188229] (1 PDB entry)

8. Domain d2oxva_: 2oxv A: [166918]
   automated match to d1ckqa_
   protein/DNA complex; mutant

Details for d2oxva_

PDB Entry: 2oxv, 1.95 Å

PDB Description: structure of the a138t promiscuous mutant of the ecori restriction endonuclease bound to its cognate recognition site.

PDB Compounds: (A:) Type II restriction enzyme EcoRI

SCOPe Domain Sequences for d2oxva_:

Sequence; same for both SEQRES and ATOM records:

>d2oxva_ c.52.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
sqgvigifgdyakahdlavgevsklvkkalsneypqlsfryrdsikkteinealkkidpd
lggtlfvsnssikpdggivevkddygewrvvlvaeakhqgkdiinirngllvgkrgdqdl
mtagnaiershkniseianfmlseshfpyvlflegsnfltenisitrpdgrvvnleynsg
ilnrldrltaanygmpinsnlcinkfvnhkdksimlqaasiytqgdgrewdskimfeimf
disttslrvlgrdlfeqltsk

Timeline for d2oxva_:

• d2oxva_ first appeared in SCOPe 2.01
  
• d2oxva_ appears in SCOPe 2.04
  
• d2oxva_ appears in SCOPe 2.06
  
• d2oxva_ appears in the current release, SCOPe 2.08