Lineage for d2ojyd_ (2ojy D:)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1064542Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily)
    disulfide-rich; nearly all-beta
  4. 1064543Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families) (S)
  5. 1064601Family g.21.1.0: automated matches [191380] (1 protein)
    not a true family
  6. 1064602Protein automated matches [190474] (1 species)
    not a true protein
  7. 1064603Species Alcaligenes faecalis [TaxId:511] [187398] (27 PDB entries)
  8. 1064642Domain d2ojyd_: 2ojy D: [166720]
    automated match to d1mg2b_
    complexed with tsr

Details for d2ojyd_

PDB Entry: 2ojy (more details), 1.6 Å

PDB Description: Crystal structure of indol-3-acetaldehyde derived TTQ-amide adduct of aromatic amine dehydrogenase
PDB Compounds: (D:) Aromatic amine dehydrogenase, small subunit

SCOPe Domain Sequences for d2ojyd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ojyd_ g.21.1.0 (D:) automated matches {Alcaligenes faecalis [TaxId: 511]}
evnscdywrhcavdgflcsccggttttcppgstpspiswigtchnphdgkdylisyhdcc
gktacgrcqcntqtrerpgyefflhndvnwcmanenstfhcttsvlvgla

SCOPe Domain Coordinates for d2ojyd_:

Click to download the PDB-style file with coordinates for d2ojyd_.
(The format of our PDB-style files is described here.)

Timeline for d2ojyd_: