SCOPe 2.01: Domain d2oizh_: 2oiz H:

Lineage for d2oizh_ (2oiz H:)

1. Root: SCOPe 2.01

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily)
   disulfide-rich; nearly all-beta

4. Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families)

5. Family g.21.1.0: automated matches [191380] (1 protein)
   not a true family

6. Protein automated matches [190474] (1 species)
   not a true protein

7. Species Alcaligenes faecalis [TaxId:511] [187398] (27 PDB entries)

8. Domain d2oizh_: 2oiz H: [166712]
   automated match to d1mg2b_
   complexed with pg4, tsr

Details for d2oizh_

PDB Entry: 2oiz, 1.05 Å

PDB Description: crystal structure of the tryptamine-derived (indol-3-acetamide)-ttq adduct of aromatic amine dehydrogenase

PDB Compounds: (H:) Aromatic amine dehydrogenase, small subunit

SCOPe Domain Sequences for d2oizh_:

Sequence; same for both SEQRES and ATOM records:

>d2oizh_ g.21.1.0 (H:) automated matches {Alcaligenes faecalis [TaxId: 511]}
hislnpdlanedevnscdywrhcavdgflcsccggttttcppgstpspiswigtchnphd
gkdylisyhdccgktacgrcqcntqtrerpgyefflhndvnwcmanenstfhcttsvlvg
la

Timeline for d2oizh_:

• d2oizh_ is new in SCOPe 2.01-stable
  
• d2oizh_ appears in SCOPe 2.02
  
• d2oizh_ appears in the current release, SCOPe 2.08