Lineage for d1bfru_ (1bfr U:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 279616Fold a.25: Ferritin-like [47239] (2 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 279617Superfamily a.25.1: Ferritin-like [47240] (2 families) (S)
    contains dimetal-ion centre in the middle of the bundle
  5. 279618Family a.25.1.1: Ferritin [47241] (5 proteins)
  6. 279669Protein Bacterioferritin (cytochrome b1) [47244] (3 species)
    binds haem between two subunits; 24-mer
  7. 279719Species Escherichia coli [TaxId:562] [47245] (2 PDB entries)
  8. 279742Domain d1bfru_: 1bfr U: [16670]

Details for d1bfru_

PDB Entry: 1bfr (more details), 2.94 Å

PDB Description: iron storage and electron transport

SCOP Domain Sequences for d1bfru_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bfru_ a.25.1.1 (U:) Bacterioferritin (cytochrome b1) {Escherichia coli}
mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
ieilrdeeghidwleteldliqkmglqnylqaqireeg

SCOP Domain Coordinates for d1bfru_:

Click to download the PDB-style file with coordinates for d1bfru_.
(The format of our PDB-style files is described here.)

Timeline for d1bfru_: