Class a: All alpha proteins [46456] (179 folds) |
Fold a.25: Ferritin-like [47239] (2 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (2 families) contains dimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (5 proteins) |
Protein Bacterioferritin (cytochrome b1) [47244] (3 species) binds haem between two subunits; 24-mer |
Species Escherichia coli [TaxId:562] [47245] (2 PDB entries) |
Domain d1bfrc_: 1bfr C: [16652] |
PDB Entry: 1bfr (more details), 2.94 Å
SCOP Domain Sequences for d1bfrc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bfrc_ a.25.1.1 (C:) Bacterioferritin (cytochrome b1) {Escherichia coli} mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm ieilrdeeghidwleteldliqkmglqnylqaqireeg
Timeline for d1bfrc_: