Lineage for d2ofka_ (2ofk A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006171Fold a.96: DNA-glycosylase [48149] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2006172Superfamily a.96.1: DNA-glycosylase [48150] (7 families) (S)
  5. 2006284Family a.96.1.4: 3-Methyladenine DNA glycosylase I (Tag) [74756] (1 protein)
    automatically mapped to Pfam PF03352
  6. 2006285Protein 3-Methyladenine DNA glycosylase I (Tag) [74757] (2 species)
  7. 2006290Species Salmonella typhi [TaxId:601] [187956] (2 PDB entries)
  8. 2006291Domain d2ofka_: 2ofk A: [166681]
    automated match to d1lmza_
    complexed with pge, zn

Details for d2ofka_

PDB Entry: 2ofk (more details), 1.5 Å

PDB Description: Crystal Structure of 3-methyladenine DNA glycosylase I (TAG)
PDB Compounds: (A:) 3-methyladenine DNA glycosylase I, constitutive

SCOPe Domain Sequences for d2ofka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ofka_ a.96.1.4 (A:) 3-Methyladenine DNA glycosylase I (Tag) {Salmonella typhi [TaxId: 601]}
qrcdwvsqdplyiayhdnewgvpetdsrklfemiclegqqaglswitvlkkrenyracfh
qfdpiriaamqeedverllqntgiirhrgkiqaiisnarawlameqngesfadfvwsfvd
gqpqitqaasldkiptstpasdalakalkkrgfkfvgtticysfmqacglvndhitgcfc
hp

SCOPe Domain Coordinates for d2ofka_:

Click to download the PDB-style file with coordinates for d2ofka_.
(The format of our PDB-style files is described here.)

Timeline for d2ofka_: