SCOPe 2.02: Domain d2odeb_: 2ode B:

Lineage for d2odeb_ (2ode B:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
   multihelical; consists of two all-alpha subdomains
   contains a 4-helical bundle with left-handed twist and up-and-down topology

4. Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families)

5. Family a.91.1.1: Regulator of G-protein signaling, RGS [48098] (10 proteins)

6. Protein automated matches [190756] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187954] (2 PDB entries)

8. Domain d2odeb_: 2ode B: [166648]
   automated match to d2ik8b1
   complexed with alf, gdp, mg

Details for d2odeb_

PDB Entry: 2ode, 1.9 Å

PDB Description: Crystal structure of the heterodimeric complex of human RGS8 and activated Gi alpha 3

PDB Compounds: (B:) Regulator of G-protein signaling 8

SCOPe Domain Sequences for d2odeb_:

Sequence; same for both SEQRES and ATOM records:

>d2odeb_ a.91.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
steeatrwadsfdvllshkygvaafraflktefseenlefwlaceefkktrstaklvska
hrifeefvdvqaprevnidfqtreatrknlqepsltcfdqaqgkvhslmekdsyprflrs
kmyldllsqsq

Timeline for d2odeb_:

• d2odeb_ first appeared in SCOPe 2.01
  
• d2odeb_ appears in SCOPe 2.03
  
• d2odeb_ appears in the current release, SCOPe 2.08