SCOPe 2.06: Domain d2obkc_: 2obk C:

Lineage for d2obkc_ (2obk C:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.23: Selenoprotein W-related [142411] (4 proteins)
   Pfam PF05169; "minimalized" version of the thioredoxin-like fold

6. Protein automated matches [190755] (4 species)
   not a true protein

7. Species Pseudomonas fluorescens [TaxId:220664] [187951] (1 PDB entry)

8. Domain d2obkc_: 2obk C: [166623]
   automated match to d2fa8a1

Details for d2obkc_

PDB Entry: 2obk, 2.7 Å

PDB Description: X-Ray structure of the putative Se binding protein from Pseudomonas fluorescens. Northeast Structural Genomics Consortium target PlR6.

PDB Compounds: (C:) SelT/selW/selH selenoprotein domain

SCOPe Domain Sequences for d2obkc_:

Sequence; same for both SEQRES and ATOM records:

>d2obkc_ c.47.1.23 (C:) automated matches {Pseudomonas fluorescens [TaxId: 220664]}
erkpeviityctqcqwllraawlaqellstfsddlgkvslepatggafritcdgvqiwer
kadggfpeakvlkqrvrdqidp

Timeline for d2obkc_:

• d2obkc_ first appeared in SCOPe 2.01
  
• d2obkc_ appears in SCOPe 2.05
  
• d2obkc_ appears in SCOPe 2.07
  
• d2obkc_ appears in the current release, SCOPe 2.08