SCOPe 2.04: Domain d2ob1b_: 2ob1 B:

Lineage for d2ob1b_ (2ob1 B:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families)

5. Family c.66.1.37: Leucine carboxy methyltransferase Ppm1 [102569] (1 protein)

6. Protein Leucine carboxy methyltransferase Ppm1 [102570] (1 species)
   involved in the regulation of protein phosphatase 2a activity

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [102571] (6 PDB entries)

8. Domain d2ob1b_: 2ob1 B: [166615]
   automated match to d1rjda_
   complexed with po4

Details for d2ob1b_

PDB Entry: 2ob1, 1.9 Å

PDB Description: ppm1 with 1,8-ANS

PDB Compounds: (B:) Leucine carboxyl methyltransferase 1

SCOPe Domain Sequences for d2ob1b_:

Sequence; same for both SEQRES and ATOM records:

>d2ob1b_ c.66.1.37 (B:) Leucine carboxy methyltransferase Ppm1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ydalscklaaisvgylpssglqrlsvdlskkytewhrsylitlkkfsrrafgkvdkamrs
sfpvmnygtylrtvgidaaileflvanekvqvvnlgcgsdlrmlpllqmfphlayvdidy
nesvelknsilreseilrislglskedtakspflidqgryklaacdlnditettrlldvc
tkreiptivisecllcymhnnesqllintimskfshglwisydpiggsqpndrfgaimqs
nlkesrnlemptlmtynskekyasrwsaapnvivndmweifnaqipeserkrlrslqfld
eleelkvmqthyilmkaqw

Timeline for d2ob1b_:

• d2ob1b_ first appeared in SCOPe 2.01
  
• d2ob1b_ appears in SCOPe 2.03
  
• d2ob1b_ appears in SCOPe 2.05
  
• d2ob1b_ appears in the current release, SCOPe 2.08