Lineage for d2nxqa_ (2nxq A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2323235Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2323236Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2323718Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 2324173Protein EHCABP [69021] (1 species)
  7. 2324174Species Entamoeba (Entamoeba histolytica) [TaxId:5759] [69022] (3 PDB entries)
  8. 2324175Domain d2nxqa_: 2nxq A: [166443]
    automated match to d1jfja_
    complexed with act, ca

Details for d2nxqa_

PDB Entry: 2nxq (more details), 2.4 Å

PDB Description: crystal structure of calcium binding protein 1 from entamoeba histolytica: a novel arrangement of ef hand motifs
PDB Compounds: (A:) calcium-binding protein

SCOPe Domain Sequences for d2nxqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nxqa_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]}
aealfkeidvngdgavsyeevkafvskkraikneqllqlifksidadgngeidqnefakf
ygsiqg

SCOPe Domain Coordinates for d2nxqa_:

Click to download the PDB-style file with coordinates for d2nxqa_.
(The format of our PDB-style files is described here.)

Timeline for d2nxqa_: