SCOP 1.61: Domain d1g4us1: 1g4u S:167-296

Lineage for d1g4us1 (1g4u S:167-296)

1. Root: SCOP 1.61

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (14 superfamilies)

4. Superfamily a.24.11: Bacterial GAP domain [47233] (1 family)

5. Family a.24.11.1: Bacterial GAP domain [47234] (3 proteins)

6. Protein SptP tyrosine phosphatase [47237] (1 species)

7. Species Salmonella typhimurium [TaxId:90371] [47238] (2 PDB entries)

8. Domain d1g4us1: 1g4u S:167-296 [16643]
   Other proteins in same PDB: d1g4ur_, d1g4us2

Details for d1g4us1

PDB Entry: 1g4u, 2.3 Å

PDB Description: crystal structure of the salmonella tyrosine phosphatase and gtpase activating protein sptp bound to rac1

SCOP Domain Sequences for d1g4us1:

Sequence; same for both SEQRES and ATOM records:

>d1g4us1 a.24.11.1 (S:167-296) SptP tyrosine phosphatase {Salmonella typhimurium}
skqplldialkglkrtlpqleqmdgnslrenfqemasgngplrslmtnlqnlnkipeakq
lndyvttltniqvgvarfsqwgtcggeverwvdkastheltqavkkihviakelknvtae
lekieagapm

Timeline for d1g4us1:

• d1g4us1 first appeared (with stable ids) in SCOP 1.55
  
• d1g4us1 appears in SCOP 1.59
  
• d1g4us1 appears in SCOP 1.63
  
• d1g4us1 appears in the current release, SCOPe 2.08