Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.4: Class I DAHP synthetase [51599] (3 proteins) |
Protein 3-deoxy-D-manno-octulosonate 8-phosphate synthase (KDO8P synthase) [51602] (4 species) |
Species Aquifex aeolicus [TaxId:63363] [63922] (32 PDB entries) |
Domain d2nx3c_: 2nx3 C: [166397] automated match to d1pe1a_ complexed with 1nt, a5p, pep |
PDB Entry: 2nx3 (more details), 2.1 Å
SCOPe Domain Sequences for d2nx3c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nx3c_ c.1.10.4 (C:) 3-deoxy-D-manno-octulosonate 8-phosphate synthase (KDO8P synthase) {Aquifex aeolicus [TaxId: 63363]} kflviagpnaieseelllkvgeeikrlsekfkevefvfkssfdkanrssihsfrghgley gvkalrkvkeefglkittdiheswqaepvaevadiiqipaflcrqtdlllaaaktgravn vkkgqflapwdtknvveklkfggakeiyltergttfgynnlvvdfrslpimkqwakviyd athsvqlpgglgdksggmrefifpliraavavgcdgvfmethpepekalsdaptalplsq legiieaileirevaskyyeti
Timeline for d2nx3c_: