Lineage for d2nx3c_ (2nx3 C:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1143364Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1147695Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 1148415Family c.1.10.4: Class I DAHP synthetase [51599] (3 proteins)
  6. 1148492Protein 3-deoxy-D-manno-octulosonate 8-phosphate synthase (KDO8P synthase) [51602] (4 species)
  7. 1148493Species Aquifex aeolicus [TaxId:63363] [63922] (32 PDB entries)
  8. 1148564Domain d2nx3c_: 2nx3 C: [166397]
    automated match to d1pe1a_
    complexed with 1nt, a5p, pep

Details for d2nx3c_

PDB Entry: 2nx3 (more details), 2.1 Å

PDB Description: structural and mechanistic changes along an engineered path from metallo to non-metallo kdo8p synthase
PDB Compounds: (C:) 2-dehydro-3-deoxyphosphooctonate aldolase

SCOPe Domain Sequences for d2nx3c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nx3c_ c.1.10.4 (C:) 3-deoxy-D-manno-octulosonate 8-phosphate synthase (KDO8P synthase) {Aquifex aeolicus [TaxId: 63363]}
kflviagpnaieseelllkvgeeikrlsekfkevefvfkssfdkanrssihsfrghgley
gvkalrkvkeefglkittdiheswqaepvaevadiiqipaflcrqtdlllaaaktgravn
vkkgqflapwdtknvveklkfggakeiyltergttfgynnlvvdfrslpimkqwakviyd
athsvqlpgglgdksggmrefifpliraavavgcdgvfmethpepekalsdaptalplsq
legiieaileirevaskyyeti

SCOPe Domain Coordinates for d2nx3c_:

Click to download the PDB-style file with coordinates for d2nx3c_.
(The format of our PDB-style files is described here.)

Timeline for d2nx3c_: