SCOPe 2.07: Domain d2nqja_: 2nqj A:

Lineage for d2nqja_ (2nqj A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.15: Xylose isomerase-like [51658] (8 families)
   different families share similar but non-identical metal-binding sites

5. Family c.1.15.1: Endonuclease IV [51659] (2 proteins)

6. Protein Endonuclease IV [51660] (2 species)
   DNA repair enzyme

7. Species Escherichia coli [TaxId:562] [51661] (5 PDB entries)

8. Domain d2nqja_: 2nqj A: [166328]
   automated match to d1qtwa_
   complexed with zn; mutant

Details for d2nqja_

PDB Entry: 2nqj, 2.45 Å

PDB Description: crystal structure of escherichia coli endonuclease iv (endo iv) e261q mutant bound to damaged dna

PDB Compounds: (A:) Endonuclease 4

SCOPe Domain Sequences for d2nqja_:

Sequence; same for both SEQRES and ATOM records:

>d2nqja_ c.1.15.1 (A:) Endonuclease IV {Escherichia coli [TaxId: 562]}
mkyigahvsaagglanaairaaeidatafalftknqrqwraaplttqtidefkaacekyh
ytsaqilphdsylinlghpvtealeksrdafidemqrceqlglsllnfhpgshlmqisee
dclariaesinialdktqgvtavientagqgsnlgfkfehlaaiidgvedksrvgvcidt
chafaagydlrtpaecektfadfartvgfkylrgmhlndakstfgsrvdrhhslgegnig
hdafrwimqddrfdgiplilqtinpdiwaeeiawlkaqq

Timeline for d2nqja_:

• d2nqja_ first appeared in SCOPe 2.01
  
• d2nqja_ appears in SCOPe 2.06
  
• d2nqja_ appears in the current release, SCOPe 2.08