SCOP 1.63: Domain d1a0b__: 1a0b -

Lineage for d1a0b__ (1a0b -)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (16 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.10: Histidine-containing phosphotransfer domain, HPT domain [47226] (3 families)
   contains additional, fifth helix at the N-terminus

5. Family a.24.10.1: Aerobic respiration control sensor protein, ArcB [47227] (1 protein)

6. Protein Aerobic respiration control sensor protein, ArcB [47228] (1 species)

7. Species Escherichia coli [TaxId:562] [47229] (4 PDB entries)

8. Domain d1a0b__: 1a0b - [16631]
   complexed with zn

Details for d1a0b__

PDB Entry: 1a0b, 2.06 Å

PDB Description: histidine-containing phosphotransfer domain of arcb from escherichia coli

SCOP Domain Sequences for d1a0b__:

Sequence; same for both SEQRES and ATOM records:

>d1a0b__ a.24.10.1 (-) Aerobic respiration control sensor protein, ArcB {Escherichia coli}
ksealldipmleqylelvgpklitdglavfekmmpgyvsvlesnltaqdkkgiveeghki
kgaagsvglrhlqqlgqqiqspdlpawednvgewieemkeewrhdvevlkawvakat

Timeline for d1a0b__:

• d1a0b__ first appeared (with stable ids) in SCOP 1.55
  
• d1a0b__ appears in SCOP 1.61
  
• d1a0b__ appears in SCOP 1.65
  
• d1a0b__ appears in the current release, SCOPe 2.08, called d1a0ba_