SCOPe 2.04: Domain d2nn2b_: 2nn2 B:

Lineage for d2nn2b_ (2nn2 B:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.42: POZ domain [54694] (1 superfamily)
   core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143

4. Superfamily d.42.1: POZ domain [54695] (3 families)

5. Family d.42.1.0: automated matches [191460] (1 protein)
   not a true family

6. Protein automated matches [190710] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187857] (21 PDB entries)

8. Domain d2nn2b_: 2nn2 B: [166309]
   automated match to d1buoa_

Details for d2nn2b_

PDB Entry: 2nn2, 2.1 Å

PDB Description: Crystal structure of the BTB domain from the LRF/ZBTB7 transcriptional regulator

PDB Compounds: (B:) Zinc finger and BTB domain-containing protein 7A

SCOPe Domain Sequences for d2nn2b_:

Sequence, based on SEQRES records:

>d2nn2b_ d.42.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gpigipfpdhssdilsglneqrtqgllcdvvilvegrefpthrsvlaacsqyfkklftsg
avvdqqnvyeidfvsaealtalmdfaytatltvstanvgdilsaarlleipavshvcadl
ldr

Sequence, based on observed residues (ATOM records):

>d2nn2b_ d.42.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gpigipfpdhssdilsglneqrtqgllcdvvilvegrefpthrsvlaacsqyfkklftsq
nvyeidfvsaealtalmdfaytatltvstanvgdilsaarlleipavshvcadlldr

Timeline for d2nn2b_:

• d2nn2b_ first appeared in SCOPe 2.01
  
• d2nn2b_ appears in SCOPe 2.03
  
• d2nn2b_ appears in SCOPe 2.05
  
• d2nn2b_ appears in the current release, SCOPe 2.08