Lineage for d2nlsa_ (2nls A:)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1063494Fold g.9: Defensin-like [57391] (1 superfamily)
    Disulfide-rich fold, nearly all-beta
  4. 1063495Superfamily g.9.1: Defensin-like [57392] (3 families) (S)
  5. 1063496Family g.9.1.1: Defensin [57393] (11 proteins)
  6. 1063576Protein automated matches [190738] (1 species)
    not a true protein
  7. 1063577Species Human (Homo sapiens) [TaxId:9606] [187916] (17 PDB entries)
  8. 1063578Domain d2nlsa_: 2nls A: [166300]
    automated match to d1e4sa_
    mutant

Details for d2nlsa_

PDB Entry: 2nls (more details), 0.98 Å

PDB Description: human beta-defensin-1 (mutant gln24ala)
PDB Compounds: (A:) beta-defensin 1

SCOPe Domain Sequences for d2nlsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nlsa_ g.9.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dhyncvssggqclysacpiftkiqgtcyrgeakcck

SCOPe Domain Coordinates for d2nlsa_:

Click to download the PDB-style file with coordinates for d2nlsa_.
(The format of our PDB-style files is described here.)

Timeline for d2nlsa_: