Lineage for d2nlcc_ (2nlc C:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3032898Fold g.9: Defensin-like [57391] (1 superfamily)
    Disulfide-rich fold, nearly all-beta
  4. 3032899Superfamily g.9.1: Defensin-like [57392] (3 families) (S)
  5. 3032900Family g.9.1.1: Defensin [57393] (11 proteins)
  6. 3032983Protein automated matches [190738] (3 species)
    not a true protein
  7. 3032986Species Human (Homo sapiens) [TaxId:9606] [187916] (17 PDB entries)
  8. 3033014Domain d2nlcc_: 2nlc C: [166274]
    automated match to d1e4sa_
    complexed with act, so4; mutant

Details for d2nlcc_

PDB Entry: 2nlc (more details), 1.65 Å

PDB Description: human beta-defensin-1 (mutant ser8ala)
PDB Compounds: (C:) beta-defensin 1

SCOPe Domain Sequences for d2nlcc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nlcc_ g.9.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dhyncvsaggqclysacpiftkiqgtcyrgkakcck

SCOPe Domain Coordinates for d2nlcc_:

Click to download the PDB-style file with coordinates for d2nlcc_.
(The format of our PDB-style files is described here.)

Timeline for d2nlcc_: