Lineage for d2jkrb_ (2jkr B:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1095602Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1095603Superfamily a.118.1: ARM repeat [48371] (24 families) (S)
  5. 1095818Family a.118.1.10: Clathrin adaptor core protein [74771] (3 proteins)
  6. 1095825Protein automated matches [190425] (1 species)
    not a true protein
  7. 1095826Species Human (Homo sapiens) [TaxId:9606] [187313] (1 PDB entry)
  8. 1095827Domain d2jkrb_: 2jkr B: [166247]
    Other proteins in same PDB: d2jkri_, d2jkrs_
    automated match to d1gw5b_
    complexed with so4

Details for d2jkrb_

PDB Entry: 2jkr (more details), 2.98 Å

PDB Description: ap2 clathrin adaptor core with dileucine peptide rm(phosphos)qikrllse
PDB Compounds: (B:) AP-2 complex subunit beta-1

SCOPe Domain Sequences for d2jkrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jkrb_ a.118.1.10 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kgeifelkaelnnekkekrkeavkkviaamtvgkdvsslfpdvvncmqtdnlelkklvyl
ylmnyaksqpdmaimavnsfvkdcedpnpliralavrtmgcirvdkiteylceplrkclk
dedpyvrktaavcvaklhdinaqmvedqgfldslrdliadsnpmvvanavaalseisesh
pnsnlldlnpqninklltalnectewgqifildclsnynpkddreaqsicervtprlsha
nsavvlsavkvlmkflellpkdsdyynmllkklapplvtllsgepevqyvalrninlivq
krpeilkqeikvffvkyndpiyvklekldimirlasqaniaqvlaelkeyatevdvdfvr
kavraigrcaikveqsaercvstlldliqtkvnyvvqeaivvirdifrkypnkyesiiat
lcenldsldepdaraamiwivgeyaeridnadellesflegfhdestqvqltlltaivkl
flkkpsetqelvqqvlslatqdsdnpdlrdrgyiywrllstdpvtakevvlsekplisee
tdlieptlldelichigslasvyhkppnafv

SCOPe Domain Coordinates for d2jkrb_:

Click to download the PDB-style file with coordinates for d2jkrb_.
(The format of our PDB-style files is described here.)

Timeline for d2jkrb_: