SCOPe 2.04: Domain d2jhta_: 2jht A:

Lineage for d2jhta_ (2jht A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.8: RhoGDI-like [81288] (3 proteins)

6. Protein automated matches [190534] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187499] (8 PDB entries)

8. Domain d2jhta_: 2jht A: [166197]
   automated match to d1ft3a_
   complexed with li, so4; mutant

Details for d2jhta_

PDB Entry: 2jht, 1.88 Å

PDB Description: crystal structure of rhogdi k135t,k138t,k141t mutant

PDB Compounds: (A:) rho GDP-dissociation inhibitor 1

SCOPe Domain Sequences for d2jhta_:

Sequence; same for both SEQRES and ATOM records:

>d2jhta_ b.1.18.8 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
amvpnvvvtgltlvcssapgpleldltgdlesfkkqsfvlkegveyrikisfrvnreivs
gmkyiqhtyrtgvtidttdymvgsygpraeeyefltpveeapkgmlargsysiksrftdd
dktdhlswewnltikkdw

Timeline for d2jhta_:

• d2jhta_ first appeared in SCOPe 2.01
  
• d2jhta_ appears in SCOPe 2.03
  
• d2jhta_ appears in SCOPe 2.05
  
• d2jhta_ appears in the current release, SCOPe 2.08