Lineage for d2jgza_ (2jgz A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2218047Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2218048Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2218179Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2218765Protein Cyclin-dependent PK, CDK2 [88855] (2 species)
    CMGC group; CDKs subfamily; serine/threonine kinase
  7. 2218766Species Human (Homo sapiens) [TaxId:9606] [88856] (374 PDB entries)
    Uniprot P24941
  8. 2219198Domain d2jgza_: 2jgz A: [166188]
    automated match to d1h24a_

Details for d2jgza_

PDB Entry: 2jgz (more details), 2.9 Å

PDB Description: crystal structure of phospho-cdk2 in complex with cyclin b
PDB Compounds: (A:) Cell division protein kinase 2

SCOPe Domain Sequences for d2jgza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jgza_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]}
smenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkeln
hpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafch
shrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgcky
ystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykps
fpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqd

SCOPe Domain Coordinates for d2jgza_:

Click to download the PDB-style file with coordinates for d2jgza_.
(The format of our PDB-style files is described here.)

Timeline for d2jgza_: