![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.86: eIF4e-like [55417] (1 superfamily) beta(2)-alpha-beta(2)-alpha-beta(2)-alpha-beta-2; 2 layers: alpha/beta; antiparallel sheet: 21356478 |
![]() | Superfamily d.86.1: eIF4e-like [55418] (3 families) ![]() |
![]() | Family d.86.1.0: automated matches [191459] (1 protein) not a true family |
![]() | Protein automated matches [190708] (8 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187914] (7 PDB entries) |
![]() | Domain d2jgca_: 2jgc A: [166175] automated match to d1ej1a_ |
PDB Entry: 2jgc (more details), 2.4 Å
SCOPe Domain Sequences for d2jgca_:
Sequence, based on SEQRES records: (download)
>d2jgca_ d.86.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} vvpgpaehplqynytfwysrrtpgrptssqsyeqnikqigtfasveqfwrfyshmvrpgd ltghsdfhlfkegikpmweddanknggkwiirlrkglasrcwenlilamlgeqfmvgeei cgavvsvrfqediisiwnktasdqattarirdtlrrvlnlppntimeykthtdsikmpgr lgpqrllf
>d2jgca_ d.86.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} vvpgpaehplqynytfwysrrtpgrqnikqigtfasveqfwrfyshmvrpgdltghsdfh lfkegikpmweddanknggkwiirlrkglasrcwenlilamlgeqfmvgeeicgavvsvr fqediisiwnktasdqattarirdtlrrvlnlppntimeykthtdgpqrllf
Timeline for d2jgca_: