Lineage for d2jgca_ (2jgc A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2204134Fold d.86: eIF4e-like [55417] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha-beta(2)-alpha-beta-2; 2 layers: alpha/beta; antiparallel sheet: 21356478
  4. 2204135Superfamily d.86.1: eIF4e-like [55418] (3 families) (S)
  5. 2204224Family d.86.1.0: automated matches [191459] (1 protein)
    not a true family
  6. 2204225Protein automated matches [190708] (8 species)
    not a true protein
  7. 2204254Species Human (Homo sapiens) [TaxId:9606] [187914] (7 PDB entries)
  8. 2204259Domain d2jgca_: 2jgc A: [166175]
    automated match to d1ej1a_

Details for d2jgca_

PDB Entry: 2jgc (more details), 2.4 Å

PDB Description: structure of the human eif4e homologous protein, 4ehp without ligand bound
PDB Compounds: (A:) eukaryotic translation initiation factor 4e type 2

SCOPe Domain Sequences for d2jgca_:

Sequence, based on SEQRES records: (download)

>d2jgca_ d.86.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vvpgpaehplqynytfwysrrtpgrptssqsyeqnikqigtfasveqfwrfyshmvrpgd
ltghsdfhlfkegikpmweddanknggkwiirlrkglasrcwenlilamlgeqfmvgeei
cgavvsvrfqediisiwnktasdqattarirdtlrrvlnlppntimeykthtdsikmpgr
lgpqrllf

Sequence, based on observed residues (ATOM records): (download)

>d2jgca_ d.86.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vvpgpaehplqynytfwysrrtpgrqnikqigtfasveqfwrfyshmvrpgdltghsdfh
lfkegikpmweddanknggkwiirlrkglasrcwenlilamlgeqfmvgeeicgavvsvr
fqediisiwnktasdqattarirdtlrrvlnlppntimeykthtdgpqrllf

SCOPe Domain Coordinates for d2jgca_:

Click to download the PDB-style file with coordinates for d2jgca_.
(The format of our PDB-style files is described here.)

Timeline for d2jgca_: