Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.219: PP2C-like [81607] (1 superfamily) 4 layers: alpha/beta/beta/alpha; antiparallel beta sheets |
Superfamily d.219.1: PP2C-like [81606] (2 families) contain binuclear metal (Mn) centre |
Family d.219.1.0: automated matches [191371] (1 protein) not a true family |
Protein automated matches [190449] (7 species) not a true protein |
Species Mycobacterium smegmatis [TaxId:246196] [187357] (3 PDB entries) |
Domain d2jfra_: 2jfr A: [166168] automated match to d1txoa_ complexed with cl, mg, mn, po4 |
PDB Entry: 2jfr (more details), 0.83 Å
SCOPe Domain Sequences for d2jfra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jfra_ d.219.1.0 (A:) automated matches {Mycobacterium smegmatis [TaxId: 246196]} gmasvlsaatatdqgpvrennqdacladgilyavadgfgarghhasatalktlsagfaaa pdrdglleavqqanlrvfellgdeptvsgttltavavfepgqggplvvnigdsplyrird ghmeqltddhsvagelvrmgeitrhearwhpqrhlltralgigphigpdvfgidcgpgdr llissdglfaaadealivdaatspdpqvavrrlvevandaggsdnttvvvidlg
Timeline for d2jfra_: