Lineage for d2jfra_ (2jfr A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3007405Fold d.219: PP2C-like [81607] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; antiparallel beta sheets
  4. 3007406Superfamily d.219.1: PP2C-like [81606] (2 families) (S)
    contain binuclear metal (Mn) centre
  5. 3007425Family d.219.1.0: automated matches [191371] (1 protein)
    not a true family
  6. 3007426Protein automated matches [190449] (7 species)
    not a true protein
  7. 3007429Species Mycobacterium smegmatis [TaxId:246196] [187357] (3 PDB entries)
  8. 3007430Domain d2jfra_: 2jfr A: [166168]
    automated match to d1txoa_
    complexed with cl, mg, mn, po4

Details for d2jfra_

PDB Entry: 2jfr (more details), 0.83 Å

PDB Description: crystal structure of the ppm ser-thr phosphatase mspp from mycobacterium smegmatis in complex with phosphate at 0.83 a resolution
PDB Compounds: (A:) ser-thr phosphatase mspp

SCOPe Domain Sequences for d2jfra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jfra_ d.219.1.0 (A:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
gmasvlsaatatdqgpvrennqdacladgilyavadgfgarghhasatalktlsagfaaa
pdrdglleavqqanlrvfellgdeptvsgttltavavfepgqggplvvnigdsplyrird
ghmeqltddhsvagelvrmgeitrhearwhpqrhlltralgigphigpdvfgidcgpgdr
llissdglfaaadealivdaatspdpqvavrrlvevandaggsdnttvvvidlg

SCOPe Domain Coordinates for d2jfra_:

Click to download the PDB-style file with coordinates for d2jfra_.
(The format of our PDB-style files is described here.)

Timeline for d2jfra_: