SCOPe 2.07: Domain d2jecd1: 2jec D:3-239

Lineage for d2jecd1 (2jec D:3-239)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.1: Legume lectins [49900] (5 proteins)

6. Protein automated matches [190035] (28 species)
   not a true protein

7. Species Mucana (Dioclea grandiflora) [TaxId:3837] [188247] (3 PDB entries)

8. Domain d2jecd1: 2jec D:3-239 [166146]
   Other proteins in same PDB: d2jeca2, d2jecb2, d2jecc2, d2jecd2
   automated match to d1dgla_
   complexed with ca, mn, xmm; mutant

Details for d2jecd1

PDB Entry: 2jec, 2 Å

PDB Description: crystal structure of recombinant dioclea grandiflora lectin mutant e123a-h131n-k132q complexed with 5-bromo-4-chloro-3-indolyl-a-d- mannose

PDB Compounds: (D:) Lectin alpha chain

SCOPe Domain Sequences for d2jecd1:

Sequence; same for both SEQRES and ATOM records:

>d2jecd1 b.29.1.1 (D:3-239) automated matches {Mucana (Dioclea grandiflora) [TaxId: 3837]}
adtivaveldsypntdigdpnyphigidiksirskstarwnmqtgkvgtvhisynsvakr
lsavvsysgsssttvsydvdlnnvlpewvrvglsattglyketntilswsftsklktnsi
adanslhfsfnqfsqnpkdlilqgdaftdsdgnlqltkvsssgdpqgnsvgralfyapvh
iweksavvasfdatftflikspdrepadgitffiantdtsipsgsggrllglfpdan

Timeline for d2jecd1:

• d2jecd1 first appeared in SCOPe 2.01, called d2jecd_
  
• d2jecd1 appears in SCOPe 2.06
  
• d2jecd1 appears in the current release, SCOPe 2.08