Lineage for d2jd89_ (2jd8 9:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2314151Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2317148Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 2317149Protein automated matches [190036] (58 species)
    not a true protein
  7. 2317999Species Pyrococcus furiosus [TaxId:2261] [187908] (4 PDB entries)
  8. 2318081Domain d2jd89_: 2jd8 9: [166092]
    automated match to d1vlga_
    complexed with fe, so4, zn

Details for d2jd89_

PDB Entry: 2jd8 (more details), 2.8 Å

PDB Description: crystal structure of the zn-soaked ferritin from the hyperthermophilic archaeal anaerobe pyrococcus furiosus
PDB Compounds: (9:) ferritin homolog

SCOPe Domain Sequences for d2jd89_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jd89_ a.25.1.0 (9:) automated matches {Pyrococcus furiosus [TaxId: 2261]}
mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg

SCOPe Domain Coordinates for d2jd89_:

Click to download the PDB-style file with coordinates for d2jd89_.
(The format of our PDB-style files is described here.)

Timeline for d2jd89_: