Lineage for d2jblh2 (2jbl H:1-36)

  1. Root: SCOPe 2.01
  2. 1058004Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1059389Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 1059761Superfamily f.23.10: Photosystem II reaction centre subunit H, transmembrane region [81490] (1 family) (S)
  5. 1059762Family f.23.10.1: Photosystem II reaction centre subunit H, transmembrane region [81489] (1 protein)
  6. 1059763Protein Photosystem II reaction centre subunit H, transmembrane region [81488] (3 species)
  7. 1059812Species Rhodopseudomonas viridis [TaxId:1079] [81485] (11 PDB entries)
    synonym: blastochloris viridis
  8. 1059816Domain d2jblh2: 2jbl H:1-36 [165988]
    Other proteins in same PDB: d2jblc_, d2jblh1, d2jbll_, d2jblm_
    complexed with bcb, bpb, fe, hem, lda, mq7, ns5, sma, so4

Details for d2jblh2

PDB Entry: 2jbl (more details), 2.4 Å

PDB Description: photosynthetic reaction center from blastochloris viridis
PDB Compounds: (H:) reaction center protein h chain

SCOPe Domain Sequences for d2jblh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jblh2 f.23.10.1 (H:1-36) Photosystem II reaction centre subunit H, transmembrane region {Rhodopseudomonas viridis [TaxId: 1079]}
myhgalaqhldiaqlvwyaqwlviwtvvllylrred

SCOPe Domain Coordinates for d2jblh2:

Click to download the PDB-style file with coordinates for d2jblh2.
(The format of our PDB-style files is described here.)

Timeline for d2jblh2: