![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.1: CheY-like [52172] (8 families) ![]() |
![]() | Family c.23.1.1: CheY-related [52173] (26 proteins) |
![]() | Protein automated matches [190177] (9 species) not a true protein |
![]() | Species Escherichia coli [TaxId:562] [186909] (5 PDB entries) |
![]() | Domain d2jbab_: 2jba B: [165983] automated match to d1b00a_ complexed with na, trs; mutant |
PDB Entry: 2jba (more details), 1.45 Å
SCOPe Domain Sequences for d2jbab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jbab_ c.23.1.1 (B:) automated matches {Escherichia coli [TaxId: 562]} arrilvvedeapiremvcfvleqngfqpveaedydsavnqlnepwpdlillawmlpggsg iqfikhlkresmtrdipvvmltargeeedrvrgletgaddcitkpfspkelvarikavmr r
Timeline for d2jbab_: