SCOPe 2.04: Domain d2j8rb_: 2j8r B:

Lineage for d2j8rb_ (2j8r B:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families)

5. Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)

6. Protein Hypothetical protein PA4866 [143694] (1 species)
   Putative phosphinothricin acetyltransferase

7. Species Pseudomonas aeruginosa [TaxId:287] [143695] (5 PDB entries)
   Uniprot Q9HUU7 3-172! Uniprot Q9HUU7 4-172

8. Domain d2j8rb_: 2j8r B: [165946]
   automated match to d2bl1a1
   complexed with azi, gol, msl

Details for d2j8rb_

PDB Entry: 2j8r, 1.55 Å

PDB Description: structure of p. aeruginosa acetyltransferase pa4866 solved in complex with l-methionine sulfoximine

PDB Compounds: (B:) acetyltransferase pa4866 from p. aeruginosa

SCOPe Domain Sequences for d2j8rb_:

Sequence; same for both SEQRES and ATOM records:

>d2j8rb_ d.108.1.1 (B:) Hypothetical protein PA4866 {Pseudomonas aeruginosa [TaxId: 287]}
asirdagvadlpgilaiyndavgnttaiwnetpvdlanrqawfdararqgypilvasdaa
gevlgyasygdwrpfegfrgtvehsvyvrddqrgkglgvqllqalieraraqglhvmvaa
iesgnaasiglhrrlgfeisgqmpqvgqkfgrwldltfmqlnldptrsap

Timeline for d2j8rb_:

• d2j8rb_ first appeared in SCOPe 2.01
  
• d2j8rb_ appears in SCOPe 2.03
  
• d2j8rb_ appears in SCOPe 2.05
  
• d2j8rb_ appears in the current release, SCOPe 2.08