![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) ![]() |
![]() | Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins) |
![]() | Protein Hypothetical protein PA4866 [143694] (1 species) Putative phosphinothricin acetyltransferase |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [143695] (5 PDB entries) Uniprot Q9HUU7 3-172! Uniprot Q9HUU7 4-172 |
![]() | Domain d2j8mb_: 2j8m B: [165942] automated match to d2bl1a1 complexed with azi, gol, so4 |
PDB Entry: 2j8m (more details), 1.44 Å
SCOPe Domain Sequences for d2j8mb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j8mb_ d.108.1.1 (B:) Hypothetical protein PA4866 {Pseudomonas aeruginosa [TaxId: 287]} asirdagvadlpgilaiyndavgnttaiwnetpvdlanrqawfdararqgypilvasdaa gevlgyasygdwrpfegfrgtvehsvyvrddqrgkglgvqllqalieraraqglhvmvaa iesgnaasiglhrrlgfeisgqmpqvgqkfgrwldltfmqlnldptrsap
Timeline for d2j8mb_: