Lineage for d2j4qb_ (2j4q B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2427208Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2427417Superfamily b.85.4: dUTPase-like [51283] (2 families) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 2427418Family b.85.4.1: dUTPase-like [51284] (5 proteins)
  6. 2427431Protein Deoxycytidine triphosphate deaminase (dCTP deaminase) [117335] (2 species)
  7. 2427432Species Escherichia coli [TaxId:562] [117336] (6 PDB entries)
    Uniprot P28248
  8. 2427466Domain d2j4qb_: 2j4q B: [165892]
    automated match to d1xs1a_
    complexed with mg, ttp, tyd; mutant

Details for d2j4qb_

PDB Entry: 2j4q (more details), 2.6 Å

PDB Description: crystal structure of a e138a escherichia coli dctp deaminase mutant enzyme in complex with dttp
PDB Compounds: (B:) deoxycytidine triphosphate deaminase

SCOPe Domain Sequences for d2j4qb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j4qb_ b.85.4.1 (B:) Deoxycytidine triphosphate deaminase (dCTP deaminase) {Escherichia coli [TaxId: 562]}
mrlcdrdieawldegrlsinprppveringatvdvrlgnkfrtfrghtaafidlsgpkde
vsaaldrvmsdeivldegeafylhpgelalavtlesvtlpadlvgwldgrsslarlglmv
hvtahridpgwsgcivlafynsgklplalrpgmligalsfeplsgpavrpy

SCOPe Domain Coordinates for d2j4qb_:

Click to download the PDB-style file with coordinates for d2j4qb_.
(The format of our PDB-style files is described here.)

Timeline for d2j4qb_: